Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin

CSB-EP357829TIF
Regular price
€788,95 EUR
Sale price
€788,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: N/A

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)

Delivery time: 3-7 business days

Uniprot ID: P09989

AA Sequence: DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 24-270aa

Protein length: Full Length of Mature Protein

MW: 43.1 kDa

Alternative Name(s):

Relevance: Inactivates eukaryotic 60S ribosomal subunits.

Reference: Cloning of trichosanthin cDNA and its expression in Escherichia coli.Shaw P.C., Yung M.H., Zhu R.H., Ho W.K.K., Ng T.B., Yeung H.W.Gene 97:267-272(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share