
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Synechococcus sp. (strain JA-2-3B'a(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime)
Uniprot NO.:Q2JLQ8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAIRTRLGDLLRPLNSEYGKVAPGWGTTPLMAVFMALFAVFLLIILQIYNKSLLLEDINV SWESLSF
Protein Names:Recommended name: Photosystem II reaction center protein H Short name= PSII-H
Gene Names:Name:psbH Ordered Locus Names:CYB_1373
Expression Region:1-67
Sequence Info:full length protein
You may also like
-
Recombinant Synechococcus sp. Photosystem II reaction center protein H(psbH)
- Regular price
- €991,95 EUR
- Sale price
- €991,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Synechococcus sp. Photosystem II reaction center protein H(psbH)
- Regular price
- €990,95 EUR
- Sale price
- €990,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Synechococcus sp. Photosystem II reaction center protein Z(psbZ)
- Regular price
- €986,95 EUR
- Sale price
- €986,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Synechococcus sp. Photosystem II reaction center protein H(psbH)
- Regular price
- €990,95 EUR
- Sale price
- €990,95 EUR
- Regular price
-
- Unit price
- per
Sold out