Recombinant Sheep Somatoliberin(GHRH)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Sheep Somatoliberin(GHRH)

CSB-EP009412SH
Regular price
€788,95 EUR
Sale price
€788,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P07217

Gene Names: GHRH

Organism: Ovis aries (Sheep)

AA Sequence: YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL

Expression Region: 1-44aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 32.1 kDa

Alternative Name(s): Growth hormone-releasing factor ;GRFGrowth hormone-releasing hormone ;GHRH

Relevance: GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.

Reference: Growth hormone-releasing factor from ovine and caprine hypothalamus isolation, sequence analysis and total synthesis.Brazeau P., Boehlen P., Esch F., Ling N., Wehrenberg W.B., Guillemin R.Biochem. Biophys. Res. Commun. 125:606-614(1984)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share