Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:C6Y4A3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSVYTIAGRQFQAHQLSLAVLGSVFVGPVIYSKLFKRNKPLSAKDVPPLNAKSKEEEEFI LKYIEEHK
Protein Names:Recommended name: ATP synthase subunit K, mitochondrial
Gene Names:Name:atp19 ORF Names:SPAC25H1.10c
Expression Region:1-68
Sequence Info:full length protein
You may also like
-
Recombinant Schizosaccharomyces pombe ATP synthase subunit J, mitochondrial(atp18)
- Regular price
- €1.042,95 EUR
- Sale price
- €1.042,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Schizosaccharomyces pombe ATP synthase subunit 9, mitochondrial(atp9)
- Regular price
- €1.053,95 EUR
- Sale price
- €1.053,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Schizosaccharomyces pombe Mitochondrial import protein 1(mim1)
- Regular price
- €1.051,95 EUR
- Sale price
- €1.051,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae ATP synthase subunit K, mitochondrial(ATP19)
- Regular price
- €1.048,95 EUR
- Sale price
- €1.048,95 EUR
- Regular price
-
- Unit price
- per
Sold out