
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P24670
Gene Names: aroD
Organism: Salmonella typhi
AA Sequence: MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA
Expression Region: 1-252aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 29.6 kDa
Alternative Name(s): Type I DHQase
Relevance: Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site.
Reference: Molecular cloning and characterization of the aroD gene encoding 3-dehydroquinase from Salmonella typhi.Servos S., Chatfield S., Hone D., Levine M., Dimitriadis G., Pickard D., Dougan G., Fairweather N., Charles I.G.J. Gen. Microbiol. 137:147-152(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Salmonella typhi 3-dehydroquinate dehydratase(aroD)
- Regular price
- €750,95 EUR
- Sale price
- €750,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Salmonella heidelberg D-serine dehydratase(dsdA)
- Regular price
- €750,95 EUR
- Sale price
- €750,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Salmonella heidelberg D-serine dehydratase(dsdA)
- Regular price
- €823,95 EUR
- Sale price
- €823,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Salmonella heidelberg D-serine dehydratase(dsdA)
- Regular price
- €750,95 EUR
- Sale price
- €750,95 EUR
- Regular price
-
- Unit price
- per
Sold out