Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: Q12306
Gene Names: SMT3
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
AA Sequence: SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Expression Region: 2-98aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 27.1 kDa
Alternative Name(s):
Relevance: Not known; suppressor of MIF2 mutations.
Reference: Ulp1-SUMO crystal structure and genetic analysis reveal conserved interactions and a regulatory element essential for cell growth in yeast.Mossessova E., Lima C.D.Mol. Cell 5:865-876(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.