Recombinant Saccharomyces cerevisiae Nicotinamidase(PNC1)

Recombinant Saccharomyces cerevisiae Nicotinamidase(PNC1)

CSB-EP346834SVGe1
Regular price
€642,95 EUR
Sale price
€642,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Microbiology

Target / Protein: PNC1

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Delivery time: 3-7 business days

Uniprot ID: P53184 

AA Sequence: MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK

Tag info: NO-tagged

Expression Region: 1-216aa

Protein length: Full Length

MW: 25.0 kDa

Alternative Name(s): Nicotinamide deamidase

Relevance: Catalyzes the deamidation of nicotinamide, an early step in the NAD+ salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate.

Reference: "Identification and functional analysis of the Saccharomyces cerevisiae nicotinamidase gene, PNC1." Ghislain M., Talla E., Francois J.M. Yeast 19:215-224(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Saccharomyces cerevisiae Nicotinamidase(PNC1)
    Regular price
    €750,95 EUR
    Sale price
    €750,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Saccharomyces cerevisiae Nicotinamidase(PNC1)
    Regular price
    €642,95 EUR
    Sale price
    €642,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Saccharomyces cerevisiae Exopolyphosphatase(PPX1)
    Regular price
    €823,95 EUR
    Sale price
    €823,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Saccharomyces cerevisiae Nucleoside diphosphate kinase(YNK1)
    Regular price
    €638,95 EUR
    Sale price
    €638,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share