Recombinant Rat Glandular kallikrein-7, submandibular-renal(Klk7)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Rat Glandular kallikrein-7, submandibular-renal(Klk7)

CSB-EP012458RA
Regular price
€666,95 EUR
Sale price
€666,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P36373

Gene Names: Klk7

Organism: Rattus norvegicus (Rat)

AA Sequence: VIGGYKCEKNSQPWQVALYSFTKYLCGGVLIDPSWVITAAHCSSNNYQVWLGRNNLLEDEPFAQHRLVSQSFPHPDYKPFLMRNHTRKPGDDHSNDLMLLHLSQPADITDGVKVIDLPTEEPKVGSTCLASGWGSTKPLIWEFPDDLQCVNIHLLSNEKCIKAYKEKVTDLMLCAGELEGGKDTCTGDSGGPLLCDGVLQGITSWGSVPCAKTNMPAIYTKLIKFTSWIKEVMKENP

Expression Region: 25-261aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 30.3 kDa

Alternative Name(s): Esterase BKallikrein-related protein K1;Proteinase ARSKG-7Tissue kallikrein

Relevance: Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Predominant kallikrein protein in the kidney.

Reference: The expression of two kallikrein gene family members in the rat kidney.Brady J.M., MacDonald R.J.Arch. Biochem. Biophys. 278:342-349(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share