Recombinant Rat Alpha-synuclein(Snca)

Recombinant Rat Alpha-synuclein(Snca)

CSB-EP021912RAe0
Regular price
€639,95 EUR
Sale price
€639,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: Snca

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Rattus norvegicus (Rat)

Delivery time: 3-7 business days

Uniprot ID: P37377

AA Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA

Tag info: N-terminal GST-tagged

Expression Region: 1-140aa

Protein length: Full Length

MW: 41.5 kDa

Alternative Name(s):

Relevance: May be involved in the regulation of dopamine release and transport.

Reference: The UCH-L1 gene encodes two opposing enzymatic activities that affect alpha-synuclein degradation and Parkinson's disease susceptibility.Liu Y., Fallon L., Lashuel H.A., Liu Z., Lansbury P.T. Jr.Cell 111:209-218(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Rat Alpha-synuclein(Snca)
    Regular price
    €639,95 EUR
    Sale price
    €639,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rat Gremlin-1(Grem1)
    Regular price
    €516,95 EUR
    Sale price
    €516,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Alpha-synuclein protein(SNCA)
    Regular price
    €558,95 EUR
    Sale price
    €558,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rat Syndecan-1(Sdc1),partial
    Regular price
    €637,95 EUR
    Sale price
    €637,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share