Recombinant Raphanus sativus Defensin-like protein 2(AFP2)

Recombinant Raphanus sativus Defensin-like protein 2(AFP2)

CSB-EP339081RJP
Regular price
€749,95 EUR
Sale price
€749,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: AFP2

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Raphanus sativus (Radish)

Delivery time: 3-7 business days

Uniprot ID: P30230

AA Sequence: QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 30-80aa

Protein length: Full Length

MW: 21.7 kDa

Alternative Name(s): Cysteine-rich antifungal protein 2 Short name: AFP2 Short name: RAFP2

Relevance: Possesses antifungal activity sensitive to inorganic cations. Induces potential changes in fungal membranes and increased K+ efflux and Ca2+ uptake.

Reference: "Mutational analysis of a plant defensin from radish (Raphanus sativus L.) reveals two adjacent sites important for antifungal activity." De Samblanx G.W., Goderis I.J., Thevissen K., Raemaekers R., Fant F., Borremans F., Acland D.P., Osborn R.W., Patel S., Broekaert W.F. J. Biol. Chem. 272:1171-1179(1997).

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share