Recombinant Rabies virus  Glycoprotein(G),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Rabies virus Glycoprotein(G),partial

CSB-EP365970RID
Regular price
€745,95 EUR
Sale price
€745,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P03524

Gene Names: G

Organism: Rabies virus (strain ERA) (RABV)

AA Sequence: KFPIYTILDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYILAIKMNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYRWLRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPSGKCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRASKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSNETKWCPPDQLVNLHDFRSDEIEHLVVEELVRKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEILPSKGCLRVGGRCHPHVNGVFFNGIILGPDGNVLIPEMQSSLLQQHMELLESSVIPLVHPLADPSTVFKDGDEAEDFVEVHLPDVHNQVSGVDLGLPNWGKY

Expression Region: 20-459aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 65.5 kDa

Alternative Name(s):

Relevance: Attaches the virus to host cellular receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell mbrane. There is convincing in vitro evidence that the muscular form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecule (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein and thereby facilitate rabies virus entry into cells.

Reference: Structure of the glycoprotein gene in rabies virus.Anilionis A., Wunner W.H., Curtis P.J.Nature 294:275-278(1981)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Rabies virus Glycoprotein(G),partial
    Regular price
    €745,95 EUR
    Sale price
    €745,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rabies virus Glycoprotein(G),partial
    Regular price
    €745,95 EUR
    Sale price
    €745,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rabies virus Glycoprotein(G),partial
    Regular price
    €409,95 EUR
    Sale price
    €409,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rabies virus Glycoprotein(G),partial
    Regular price
    €818,95 EUR
    Sale price
    €818,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share