Recombinant Rabbit Apolipoprotein E(APOE),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Rabbit Apolipoprotein E(APOE),partial

CSB-EP001936RBb7
Regular price
€781,95 EUR
Sale price
€781,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Cardiovascular

Target / Protein: APOE

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Oryctolagus cuniculus (Rabbit)

Delivery time: 3-7 business days

Uniprot ID: P18287

AA Sequence: TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ

Tag info: N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged

Expression Region: 20-311aa

Protein length: Partial

MW: 50.6 kDa

Alternative Name(s):

Relevance: Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues.

Reference: "Isolation and characterization of a full-length rabbit apolipoprotein E cDNA." Hao Q.L., Yamin T.T., Pan T.C., Chen S.L., Chen B.S., Kroon P.A., Chao Y.S. Atherosclerosis 66:125-130(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share