Recombinant Puromycin N-acetyltransferase(pac)

Recombinant Puromycin N-acetyltransferase(pac)

CSB-EP319512SNI
Regular price
€796,95 EUR
Sale price
€796,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: pac

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Streptomyces alboniger

Delivery time: 3-7 business days

Uniprot ID: P13249

AA Sequence: MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIERVTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLAAQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETSAPRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-199aa

Protein length: Full Length

MW: 37.5 kDa

Alternative Name(s):

Relevance: Detoxification of puromycin.

Reference: "Molecular analysis of the pac gene encoding a puromycin N-acetyl transferase from Streptomyces alboniger."Lacalle R.A., Pulido D., Vara J., Zalacain M., Jimenez A.Gene 79:375-380(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share