Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: V5N6H2
Gene Names: ORF7
Organism: Porcine reproductive and respiratory syndrome virus (PRRSV)
AA Sequence: MPNNNGKQQKRKKGDGQPVNQLCQMLGKIITQQNQSRGKGPGKKNKKKNPEKPHFPLATEDDVRHHFTPSERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVTASPSA
Expression Region: 1-123aa
Sequence Info: Full Length
Source: E.coli
Tag Info: NO-tagged
MW: 13.6 kDa
Alternative Name(s):
Relevance:
Reference: "Genetic dissection of complete genomes of Type 2 PRRS viruses isolated in Denmark over a period of 15 years." Kvisgaard L.K., Hjulsager C.K., Brar M.S., Leung F.C., Larsen L.E. Vet. Microbiol. 167:334-344(2013)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.