Recombinant Pongo abelii Transmembrane protein 168(TMEM168),partial

Recombinant Pongo abelii Transmembrane protein 168(TMEM168),partial

CSB-BP023742PYX
Regular price
€1.501,95 EUR
Sale price
€1.501,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:Q5RD28

Gene Names:TMEM168

Organism:Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

AA Sequence:EWWREKNGSFCSRLIIVLDSENSTPWVKEVRKINDQYIAVQGAELIKTVDIEEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTLHLPTGSDVAK

Expression Region:527-637aa

Sequence Info:Partial

Source:Baculovirus

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:16.8 kDa

Alternative Name(s):TMEM168; Transmembrane protein 168

Relevance:

Reference:The German cDNA consortium Submitted (NOV-2004) to the EMBL/GenBank/DDBJ databases

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:Membrane, Multi-pass membrane protein

Protein Families:TMEM168 family

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?pon:100172041

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:28-38 business days

Your list is ready to share