Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2(LTP2)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2(LTP2)

CSB-EP345923ESB
Regular price
€617,95 EUR
Sale price
€617,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P55958

Gene Names: LTP2

Organism: Parietaria judaica (Pellitory-of-the-wall)(Parietaria diffusa)

AA Sequence: EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY

Expression Region: 32-133aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 27.3 kDa

Alternative Name(s): Allergen Par j II Major pollen allergen Par j 2.0101 Protein P2 Allergen: Par j 2.0101

Relevance: Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

Reference: "Assignment of disulphide bridges in Par j 2.0101, a major allergen of Parietaria judaica pollen." Amoresano A., Pucci P., Duro G., Colombo P., Costa M.A., Izzo V., Lamba D., Geraci D. Biol. Chem. 384:1165-1172(2003)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share