Recombinant Paenibacillus macerans Cyclomaltodextrin glucanotransferase,partial

Recombinant Paenibacillus macerans Cyclomaltodextrin glucanotransferase,partial

CSB-YP327084EQJ
Regular price
€857,95 EUR
Sale price
€857,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Microbiology

Target / Protein:

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Bacillus macerans

Delivery time: 3-7 business days

Uniprot ID: P31835 

AA Sequence: VLTADQVTVRFKVNNATTALGQNVYLTGNVAELGNWTAANAIGPMYNQVEASYPTWYFDVSVPANTALQFKFIKVNGSTVTWEGGNNHTFTSPSSGVATVTVDWQN

Tag info: N-terminal 6xHis-tagged

Expression Region: 608-713aa

Protein length: Partial

MW: 13.4 kDa

Alternative Name(s): Cyclodextrin-glycosyltransferase Short name:CGTase

Relevance:

Reference: "Polypeptide possessing cyclomaltodextrin glucanotransferase activity."Sugimoto T., Kubota M., Sakai S.Patent number GB2169902, 23-JUL-1986

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share