Recombinant Oncorhynchus mykiss  Myelin proteolipid protein(plp),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Oncorhynchus mykiss Myelin proteolipid protein(plp),partial

CSB-EP018202OEI
Regular price
€794,95 EUR
Sale price
€794,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P79826

Gene Names: plp

Organism: Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)

AA Sequence: PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD

Expression Region: 150-218aa

Sequence Info: Extracellular Domain

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 11.7 kDa

Alternative Name(s): DM20Lipophilin

Relevance: This is the major myelin protein from the central nervous syst. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation.

Reference: Cloning and expression of the proteolipid protein DM20 cDNA from the brain of the rainbow trout, Oncorhynchus mykiss.Tang S., Panno J.P., McKeown B.A.Brain Res. Mol. Brain Res. 41:134-139(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share