Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oenothera biennis (German evening primrose) (Onagra biennis)
Uniprot NO.:P60115
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLEGAKLMGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIA LFALMMAFLILFVF
Protein Names:Recommended name: ATP synthase subunit 9, mitochondrial Alternative name(s): Lipid-binding protein
Gene Names:Name:ATP9
Expression Region:1-74
Sequence Info:full length protein