
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Uniprot NO.:P75597
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNQQLNTTRKSTAARGRMGLVGGILLVIGTCIGAGIFFKSERVLQNMGGNTTLALLVWLM AGITVILMGLALVEITAKAAFDDLALLSWTQKFTNNTFYKACKRFLIWIYLPTTFFFMPL YLVQSLQDGLRGFGVANHFNTPHDWAIWMVIVLLINLWFFFTSGLSVKWTSVQNVVLLLL KVIPLIAVVILALWLGASAEQMERQPVVPVKDFTAISPFFGWFSAMGAIFFAFDGFYVSA AAKTQLKKQKNYRK
Protein Names:Recommended name: Uncharacterized protein MPN_095
Gene Names:Ordered Locus Names:MPN_095 ORF Names:MP059, R02_orf254
Expression Region:1-254
Sequence Info:full length protein
You may also like
-
Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_096 (MPN_096)
- Regular price
- €1.134,95 EUR
- Sale price
- €1.134,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_090 (MPN_090)
- Regular price
- €1.182,95 EUR
- Sale price
- €1.182,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_113 (MPN_113)
- Regular price
- €1.103,95 EUR
- Sale price
- €1.103,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_465 (MPN_465)
- Regular price
- €1.085,95 EUR
- Sale price
- €1.085,95 EUR
- Regular price
-
- Unit price
- per
Sold out