Recombinant Mouse Lymphocyte antigen 6K(Ly6k)

Recombinant Mouse Lymphocyte antigen 6K(Ly6k)

CSB-YP861475MO
Regular price
€868,95 EUR
Sale price
€868,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Immunology

Uniprot ID:Q9CWP4

Gene Names:Ly6k

Organism:Mus musculus (Mouse)

AA Sequence:LTCHVCEAQNSYACSNPSQCPGEKKFCLLAVTRIFERFFYVSKQCTRRCPTPVVSPPSTNPPSEPKEFLIEKPMPFLFYKCCQWDSCNGEGPPTDQLLKEQPG

Expression Region:21-123aa

Sequence Info:Full Length of Mature Protein

Source:Yeast

Tag Info:C-terminal 6xHis-tagged

MW:13.1

Alternative Name(s):Ly-6K

Relevance:Required for sperm migration into the oviduct and male fertility by controlling binding of sperm to zona pellucida . May play a role in cell growth .

Reference:"TEX101, a germ cell-marker glycoprotein, is associated with lymphocyte antigen 6 complex locus k within the mouse testis." Yoshitake H., Tsukamoto H., Maruyama-Fukushima M., Takamori K., Ogawa H., Araki Y. Biochem. Biophys. Res. Commun. 372:277-282(2008)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:25-35 business days

Your list is ready to share