Recombinant Mouse Kallikrein 1-related peptidase b22(Klk1b22)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Kallikrein 1-related peptidase b22(Klk1b22)

CSB-EP325391MO
Regular price
€674,95 EUR
Sale price
€674,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P15948

Gene Names: Klk1b22

Organism: Mus musculus (Mouse)

AA Sequence: ILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP

Expression Region: 25-259aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 41.8 kDa

Alternative Name(s): Beta-NGF-endopeptidase;Epidermal growth factor-binding protein type A ;EGF-BP AGlandular kallikrein K22 ;mGK-22Nerve growth factor beta chain endopeptidaseTissue kallikrein 22

Relevance: Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.

Reference: Mouse glandular kallikrein genes. Structure and partial sequence analysis of the kallikrein gene locus.Evans B.A., Drinkwater C.C., Richards R.I.J. Biol. Chem. 262:8027-8034(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share