Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q03366
Gene Names: Ccl7
Organism: Mus musculus (Mouse)
AA Sequence: PNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
Expression Region: 28-97aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 12.1 kDa
Alternative Name(s): Intercrine/chemokine MAR;CMonocyte chemoattractant protein 3Monocyte chemotactic protein 3 ;MCP-3;Protein FICSmall-inducible cytokine A7
Relevance: Chotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity .
Reference: Immunoglobulin E plus antigen challenge induces a novel intercrine/chemokine in mouse mast cells.Kulmburg P.A., Huber N.E., Scheer B.J., Wrann M., Baumruker T.J. Exp. Med. 176:1773-1778(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.