Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P00801
Gene Names: N/A
Organism: Lysobacter enzymogenes
AA Sequence: SPNGLLQFPFPRGASWHVGGAHTNTGSGNYPMSSLDMSRGGGSNQNGNWVSASAAGGSFKRHSSCFAEIVHTGGWSTTYYHLMNIQYNTGANVSMNTAIANAPNTQAQALCNGGQSTGPHQHWSLKQNGSFYHLNGTYLSGYRITATGSSYDTNCSRFYLTKNGQNYCYGYYVNPGPN
Expression Region: 1-178aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 35.1 kDa
Alternative Name(s): Beta-lytic protease
Relevance: Cleavage of N-acetylmuramoyl-|-Ala, and of the insulin B chain at 23-Gly-|-Phe-24 > 18-Val-|-Cys(SO3H).
Reference: Damaglou A.P., Allen L.C., Whitaker D.R.Submitted (MAR-1974) to the PIR data bank
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.