
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein:
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Leiurus quinquestriatus hebraeus (Yellow scorpion)
Delivery time: 3-7 business days
Uniprot ID: P17728
AA Sequence: VRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCHRK
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 20-85aa
Protein length: Full Length
MW: 23.5 kDa
Alternative Name(s): Lqh-alpha-IT Short name: Alpha-IT
Relevance: Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The dissociation is voltage-dependent. This toxin is active on insects. It is also highly toxic to crustaceans and has a measurable but low toxicity to mice.
Reference: "Nucleotide sequence and structure analysis of a cDNA encoding an alpha insect toxin from the scorpion Leiurus quinquestriatus hebraeus." Gurevitz M., Urbach D., Zlotkin E., Zilberberg N.Toxicon 29:1270-1272(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT
- Regular price
- €749,95 EUR
- Sale price
- €749,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Leiurus hebraeus Alpha-like toxin Lqh6
- Regular price
- €1.421,95 EUR
- Sale price
- €1.421,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Leiurus hebraeus Beta-mammal/insect toxin Lqhb1
- Regular price
- €1.421,95 EUR
- Sale price
- €1.421,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Leiurus quinquestriatus quinquestriatus Beta-insect excitatory toxin LqqIT1
- Regular price
- €736,95 EUR
- Sale price
- €736,95 EUR
- Regular price
-
- Unit price
- per
Sold out