Recombinant Human V-set and immunoglobulin domain-containing protein 1(VSIG1),partial

Recombinant Human V-set and immunoglobulin domain-containing protein 1(VSIG1),partial

CSB-MP769803HU1
Regular price
€711,95 EUR
Sale price
€711,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:20ug. Other sizes are also available. For further information, please contact us.

Research Areas:Immunology

Uniprot ID:Q86XK7

Gene Names:VSIG1

Organism:Homo sapiens (Human)

AA Sequence:VQVTIPDGFVNVTVGSNVTLICIYTTTVASREQLSIQWSFFHKKEMEPISIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPVKENFNPTTGILVIGNLTNFEQGYYQCTAINRLGNSSCEIDLTSSHPE

Expression Region:22-232aa

Sequence Info:Extracellular Domain

Source:Mammalian cell

Tag Info:N-terminal 10xHis-tagged

MW:26.4 kDa

Alternative Name(s):Cell surface A33 antigen (Glycoprotein A34) (GPA34)

Relevance:

Reference:"Decreased expression of V-set and immunoglobulin domain containing 1 (VSIG1) is associated with poor prognosis in primary gastric cancer." Chen Y., Pan K., Li S., Xia J., Wang W., Chen J., Zhao J., Lu L., Wang D., Pan Q., Wang Q., Li Y., He J., Li Q. J Surg Oncol 106:286-293(2012)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:Membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity:Detected only in stomach mucosa and testis, and to a much lesser level in pancreas (at protein level). Detected in gastric cancers (31%), esophageal carcinomas (50%) and ovarian cancers (23%).

Paythway:

HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:28675

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=177164

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:340547

STRING Database Link:

OMIM Database Link:https://www.omim.org/entry/300620300620300620

Lead Time Guidance:3-7 business days

Your list is ready to share