Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Cancer
Uniprot NO.:Q9NP50
Uniprot Entry Name:
Gene Names:SINHCAF
Species:Homo sapiens (Human)
Source:E.coli
Expression Region:1-221aa
Sequence:MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW
Protein Description:Full Length
Tag Info:N-terminal GST-tagged
Mol. Weight:51.9 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized LCN2 at 2 ?g/ml can bind human SINHCAF, the EC50 of human SINHCAF protein is 31.54-38.59 ?g/ml.
Purity:Greater than 85% as determined by SDS-PAGE.
Endotoxin:Not test.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:Protein FAM60A (Tera protein homolog) (C12orf14) (FAM60A)
Relevance:Subunit of the Sin3 deacetylase complex, this subunit is important for the repression of genes encoding components of the TGF-beta signaling pathway . Core component of a SIN3A complex present in embryonic stem cells. Promotes the stability of SIN3A and its presence on chromatin and is essential for maintaining the potential of ES cells to proliferate rapidly, while ensuring a short G1-phase of the cell cycle, thereby preventing premature lineage priming.
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link: