Recombinant Human Secreted and transmembrane protein 1(SECTM1),partial (Active)

Recombinant Human Secreted and transmembrane protein 1(SECTM1),partial (Active)

CSB-MP819898HU
Regular price
€363,95 EUR
Sale price
€363,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Cancer

Uniprot NO.:Q8WVN6

Uniprot Entry Name:

Gene Names:SECTM1

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:29-145aa

Sequence:QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG

Protein Description:Partial

Tag Info:C-terminal hFc-tagged

Mol. Weight:41.6 kDa

Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized CD7 (CSB-MP004953HU) at 5 ?g/ml can bind human SECTM1, the EC50 is 1.811-3.372 ng/ml.

Purity:Greater than 92% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:(Protein K-12)(K12)

Relevance:May be involved in thymocyte signaling.

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

You may also like

  • Recombinant Human Insulin growth factor-like family member 1(IGFL1) (Active)
    Regular price
    €500,95 EUR
    Sale price
    €500,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human T-cell antigen CD7(CD7),partial (Active)
    Regular price
    €363,95 EUR
    Sale price
    €363,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Basigin(BSG),partial (Active)
    Regular price
    €379,95 EUR
    Sale price
    €379,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human UL16-binding protein 1(ULBP1),Biotinylated (Active)
    Regular price
    €540,95 EUR
    Sale price
    €540,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share