Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)

CSB-CF021173HU
Regular price
€605,95 EUR
Sale price
€605,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-20 working days

Research Topic: Cell Biology

Uniprot ID: P07988

Gene Names: SFTPB

Organism: Homo sapiens(Human)

AA Sequence: FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM

Expression Region: 201-279aa

Sequence Info: Full Length

Source: in vitro E.coli expression system

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 24.7 kDa

Alternative Name(s): 18KDA pulmonary-surfactant protein 6KDA protein Pulmonary surfactant-associated proteolipid SPL(Phe)

Relevance: Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.

Reference: "cDNA and deduced amino acid sequence of human pulmonary surfactant-associated proteolipid SPL(Phe)." Glasser S.W., Korfhagen T.R., Weaver T., Pilot-Matias T., Fox J.L., Whitsett J.A. Proc. Natl. Acad. Sci. U.S.A. 84:4007-4011(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share