Recombinant Human Potassium voltage-gated channel subfamily E member 2(KCNE2)

Recombinant Human Potassium voltage-gated channel subfamily E member 2(KCNE2)

CSB-CF896548HU(A4)
Regular price
€1.684,95 EUR
Sale price
€1.684,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:20ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:Q9Y6J6

Gene Names:KCNE2

Organism:Homo sapiens (Human)

AA Sequence:MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP

Expression Region:1-123aa

Sequence Info:Full Length

Source:in vitro E.coli expression system

Tag Info:N-terminal 10xHis-tagged

MW:17.3 kDa

Alternative Name(s):Potassium voltage-gated channel subfamily E member 2(MinK-related peptide 1)(Minimum potassium ion channel-related peptide 1)(Potassium channel subunit beta MiRP1)

Relevance:Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. Associated with KCNH2/HERG is proposed to form the rapidly activating component of the delayed rectifying potassium current in heart (IKr). May associate with KCNQ2 and/or KCNQ3 and modulate the native M-type current. May associate with HCN1 and HCN2 and increase potassium current. Interacts with KCNQ1; forms a heterooligomer complex leading to currents with an apparently instantaneous activation, a rapid deactivation process and a linear current-voltage relationship and decreases the amplitude of the outward current (PubMed:11101505).

Reference:"KCNE2 confers background current characteristics to the cardiac KCNQ1 potassium channel." Tinel N., Diochot S., Borsotto M., Lazdunski M., Barhanin J. EMBO J. 19:6326-6330(2000)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

You may also like

  • Recombinant Rat Potassium voltage-gated channel subfamily E member 2(Kcne2)
    Regular price
    €639,95 EUR
    Sale price
    €639,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Kcne2 Antibody, FITC conjugated - Cat. #: CSB-PA012027LC01RA
    Regular price
    €304,95 EUR
    Sale price
    €304,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Kcne2 Antibody, Biotin conjugated - Cat. #: CSB-PA012027LD01RA
    Regular price
    €304,95 EUR
    Sale price
    €304,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Kcne2 Antibody - Cat. #: CSB-PA012027LA01RA
    Regular price
    €304,95 EUR
    Sale price
    €304,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share