
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Signal Transduction
Uniprot NO.:P23368
Uniprot Entry Name:MAOM_HUMAN
Gene Names:ME2
Species:Homo sapiens (Human)
Source:E.Coli
Expression Region:19-584aa
Sequence:MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE+HHHHHH
Protein Description:Full Length of Mature Protein
Tag Info:C-terminal 6xHis-tagged
Mol. Weight:64.4 kDa
Biological_Activity:Malic Enzyme activity was assayed spectrophotometrically at 340nm as described in Mandela and Sauer (1975). The standard reaction mixture contained 50 mM Tris-HCl, 3 mM MnCl2, 5 mM malate, 0.12 mM NADP+, 2.5 mM fumarate. Assay was performed in a Beckman spectrophotometer. The Km value is 1.5 ± 0.6 mM
Purity:>95% as determined by SDS-PAGE and HPLC.
Endotoxin:Less than 1.0 EU/µg as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2?m filtered PBS, pH 7.4.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:NAD-ME, Malic enzyme 2
Relevance:
PubMed ID:1993674; 11401430; 14702039; 16177791; 15489334; 12665801; 19608861; 21269460; 24275569; 10467136; 10700286; 12121650; 12962632
Function:
Involvement in disease:
Subcellular Location:Mitochondrion matrix
Protein Families:Malic enzymes family
Tissue Specificity:
Paythway:
HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:6984
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=233119
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:4200
STRING Database Link:https://string-db.org/network/9606.ENSP00000321070
OMIM Database Link:https://www.omim.org/entry/154270154270154270
You may also like
-
Recombinant Human NADP-dependent malic enzyme, mitochondrial(ME3),partial
- Regular price
- €639,95 EUR
- Sale price
- €639,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human NADP-dependent malic enzyme, mitochondrial(ME3),partial
- Regular price
- €639,95 EUR
- Sale price
- €639,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human 5'-nucleotidase(NT5E) (Active)
- Regular price
- €366,95 EUR
- Sale price
- €366,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Methylmalonyl-CoA mutase, mitochondrial(MUT)
- Regular price
- €565,95 EUR
- Sale price
- €565,95 EUR
- Regular price
-
- Unit price
- per
Sold out