
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Developmental Biology
Uniprot ID: P14780
Gene Names: MMP9
Organism: Homo sapiens (Human)
AA Sequence: FQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Expression Region: 107-707aa
Sequence Info: Partial
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 68.6 kDa
Alternative Name(s): 92KDA gelatinase92KDA type IV collagenaseGelatinase B ;GELB
Relevance: May play an essential role in local proteolysis of the Extracellular domain matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-|-Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.
Reference: SV40-transformed human lung fibroblasts secrete a 92-KDA type IV collagenase which is identical to that secreted by normal human macrophages.Wilhelm S.M., Collier I.E., Marmer B.L., Eisen A.Z., Grant G.A., Goldberg G.I.J. Biol. Chem. 264:17213-17221(1989)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Dog Matrix metalloproteinase-9(MMP9)
- Regular price
- €822,95 EUR
- Sale price
- €822,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH(PLOD3)
- Regular price
- €1.758,95 EUR
- Sale price
- €1.758,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human NADP-dependent malic enzyme, mitochondrial(ME3),partial
- Regular price
- €637,95 EUR
- Sale price
- €637,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Peroxisomal bifunctional enzyme(EHHADH)
- Regular price
- €498,95 EUR
- Sale price
- €498,95 EUR
- Regular price
-
- Unit price
- per
Sold out