Recombinant Human Leukemia inhibitory factor(LIF) (Active)

Recombinant Human Leukemia inhibitory factor(LIF) (Active)

CSB-MP012928HUd9
Regular price
€398,95 EUR
Sale price
€398,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Cancer

Uniprot NO.:P15018

Uniprot Entry Name:

Gene Names:LIF

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:23-202aa

Sequence:SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Protein Description:Full Length of Mature Protein

Tag Info:C-terminal hFc-tagged

Mol. Weight:48.6

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized human LIF at 2 ?g/ml can bind human LIFR (CSB-MP012929HUi9), the EC50 is 22.58-30.24 ng/ml.

Purity:Greater than 90% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:

Relevance:

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Your list is ready to share