
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cancer
Uniprot ID: P07864
Gene Names: LDHC
Organism: Homo sapiens (Human)
AA Sequence: STVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF
Expression Region: 2-332aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 52.2 kDa
Alternative Name(s): Cancer/testis antigen 32 Short name: CT32 LDH testis subunit LDH-X
Relevance: Possible role in sperm motility. (S)-lactate + NAD+ = pyruvate + NADH.
Reference: "Epitopes of human testis-specific lactate dehydrogenase deduced from a cDNA sequence."Millan J.L., Driscoll C.E., Goldberg E.Proc. Natl. Acad. Sci. U.S.A. 84:5311-5315(1987)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human L-lactate dehydrogenase C chain (LDHC) ,partial
- Regular price
- €412,95 EUR
- Sale price
- €412,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human L-lactate dehydrogenase A chain(LDHA),partial
- Regular price
- €643,95 EUR
- Sale price
- €643,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human L-lactate dehydrogenase A chain(LDHA),partial
- Regular price
- €716,95 EUR
- Sale price
- €716,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human L-lactate dehydrogenase A chain(LDHA),partial
- Regular price
- €643,95 EUR
- Sale price
- €643,95 EUR
- Regular price
-
- Unit price
- per
Sold out