
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: P08700
Gene Names: IL3
Organism: Homo sapiens (Human)
AA Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Expression Region: 20-152aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: C-terminal 6xHis-tagged
MW: 17.1 kDa
Alternative Name(s): Hematopoietic growth factor Mast cell growth factor
Relevance: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
Reference: "Association between a single-nucleotide polymorphism in the promoter of the human interleukin-3 gene and rheumatoid arthritis in Japanese patients, and maximum-likelihood estimation of combinatorial effect that two genetic loci have on susceptibility to the disease." Yamada R., Tanaka T., Unoki M., Nagai T., Sawada T., Ohnishi Y., Tsunoda T., Yukioka M., Maeda A., Suzuki K., Tateishi H., Ochi T., Nakamura Y., Yamamoto K. Am. J. Hum. Genet. 68:674-685(2001)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Interleukin-3(IL3)
- Regular price
- €498,95 EUR
- Sale price
- €498,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
IL3 Antibody, HRP conjugated - Cat. #: CSB-PA06725B0Rb
- Regular price
- €303,95 EUR
- Sale price
- €303,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
IL3 Antibody, FITC conjugated - Cat. #: CSB-PA06725C0Rb
- Regular price
- €303,95 EUR
- Sale price
- €303,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
IL3 Antibody, Biotin conjugated - Cat. #: CSB-PA06725D0Rb
- Regular price
- €303,95 EUR
- Sale price
- €303,95 EUR
- Regular price
-
- Unit price
- per
Sold out