
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: P22301
Gene Names: IL10
Organism: Homo sapiens (Human)
AA Sequence: SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Expression Region: 19-178aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 45.6 kDa
Alternative Name(s): Cytokine synthesis inhibitory factor ;CSIF
Relevance: Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Reference: A Gly15Arg mutation in the interleukin-10 gene reduces secretion of interleukin-10 in Crohn disease.van der Linde K., Boor P.P., Sandkuijl L.A., Meijssen M.A., Savelkoul H.F., Wilson J.H., de Rooij F.W.Scand. J. Gastroenterol. 38:611-617(2003)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Sheep Interleukin-10(IL10)
- Regular price
- €822,95 EUR
- Sale price
- €822,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bovine Interleukin-10(IL10)
- Regular price
- €822,95 EUR
- Sale price
- €822,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Interleukin-10 protein(IL10) (Active)
- Regular price
- €1.718,95 EUR
- Sale price
- €1.718,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Callithrix jacchus Interleukin-10(IL10)
- Regular price
- €822,95 EUR
- Sale price
- €822,95 EUR
- Regular price
-
- Unit price
- per
Sold out