
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:other
Uniprot NO.:Q6UW32
Uniprot Entry Name:
Gene Names:IGFL1
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:25-110aa
Sequence:APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
Protein Description:Full Length of Mature Protein
Tag Info:C-terminal hFc-tagged
Mol. Weight:38.7 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 (CSB-MP862025HU) at 2 ?g/mL can bind Human IGFL1, the EC50 is 32.33-47.52 ng/mL.
Purity:Greater than 95% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:
Relevance:Probable ligand of the IGFLR1 cell membrane receptor.
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Human Insulin-like growth factor II protein(IGF2) (Active)
- Regular price
- €531,95 EUR
- Sale price
- €531,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Insulin-like growth factor I protein(IGF1) (Active)
- Regular price
- €184,95 EUR
- Sale price
- €184,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Secreted and transmembrane protein 1(SECTM1),partial (Active)
- Regular price
- €369,95 EUR
- Sale price
- €369,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human UL16-binding protein 1(ULBP1),Biotinylated (Active)
- Regular price
- €549,95 EUR
- Sale price
- €549,95 EUR
- Regular price
-
- Unit price
- per
Sold out