Recombinant Human HLA class I histocompatibility antigen, alpha chain G protein(HLA-G)

Recombinant Human HLA class I histocompatibility antigen, alpha chain G protein(HLA-G)

CSB-MP010509HU
Regular price
€429,95 EUR
Sale price
€429,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug

Updated Date: Stock Protein updated on 20170405

Research areas: Immunology

Target / Protein: HLA-G

Biologically active: Not Tested

Expression system: Mammalian cell

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P17693

AA Sequence: GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Tag info: N-terminal 6xHis-tagged

Expression Region: 25-338aa

Protein length: Full Length of Mature Protein

MW: 39.6 kDa

Alternative Name(s): HLA G antigen;MHC class I antigen G

Relevance: Involved in the presentation of foreign antigens to the immune syst. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells.

Reference: Efficient leukocyte Ig-like receptor signaling and crystal structure of disulfide-linked HLA-G dimer.Shiroishi M., Kuroki K., Ose T., Rasubala L., Shiratori I., Arase H., Tsumoto K., Kumagai I., Kohda D., Maenaka K.J. Biol. Chem. 281:10439-10447(2006)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share