Size:1mg. Other sizes are also available. Please contact us.
Research Areas:Cancer
Uniprot NO.:O00214
Uniprot Entry Name:
Gene Names:LGALS8
Species:Homo sapiens (Human)
Source:E.coli
Expression Region:1-317aa
Sequence:MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Protein Description:Full Length
Tag Info:N-terminal GST-tagged
Mol. Weight:62.8 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized SLC31A1 at 5 ?g/ml can bind human LGALS8, the EC50 of human LGALS8 is 373.90-524.30 ?g/ml.
Purity:Greater than 90% as determined by SDS-PAGE.
Endotoxin:Not test.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:Po66 carbohydrate-binding protein
Relevance:Lectin with a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans.
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link: