Recombinant Human Elongation factor 1-beta(EEF1B2)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Elongation factor 1-beta(EEF1B2)

CSB-EP335050HU
Regular price
€482,95 EUR
Sale price
€482,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: P24534

Gene Names: EEF1B2

Organism: Homo sapiens (Human)

AA Sequence: GFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI

Expression Region: 1-225aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 51.6 kDa

Alternative Name(s):

Relevance: EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP.

Reference: "Human elongation factor 1 beta: cDNA and derived amino acid sequence." von der Kammer H., Klaudiny J., Zimmer M., Scheit K.H. Biochem. Biophys. Res. Commun. 177:312-317(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share