
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Signal Transduction
Target / Protein: DSP
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: P15924
AA Sequence: CSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 78-300aa
Protein length: Partial
MW: 42.1 kDa
Alternative Name(s): 250/210 kDa paraneoplastic pemphigus antigen
Relevance: Major high molecular weight protein of desmosomes. Involved in the organization of the desmosomal cadherin-plakoglobin complexes into discrete plasma mbrane domains and in the anchoring of intermediate filaments to the desmosomes.
Reference: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Desmoplakin(DSP) ,partial
- Regular price
- €499,95 EUR
- Sale price
- €499,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Desmoplakin(DSP),partial
- Regular price
- €558,95 EUR
- Sale price
- €558,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human HLA-C protein(HLA-C),partial
- Regular price
- €499,95 EUR
- Sale price
- €499,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human T-cell surface glycoprotein CD1c(CD1C),partial
- Regular price
- €725,95 EUR
- Sale price
- €725,95 EUR
- Regular price
-
- Unit price
- per
Sold out