
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Cell Biology
Uniprot NO.:Q9NYJ7
Uniprot Entry Name:
Gene Names:DLL3
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:27-492aa
Sequence:AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL
Protein Description:Partial
Tag Info:C-terminal 6xHis-tagged
Mol. Weight:51.5 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized DLL3 at 2 ?g/mL can bind Anti-DLL3 Recombinant Antibody?CSB-RA882142A1HU?, the EC50 is 1.102-1.707 ng/mL.
Purity:Greater than 71.6% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:
Relevance:
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Human Delta-like protein 3(DLL3),partial
- Regular price
- €565,95 EUR
- Sale price
- €565,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Delta-like protein 3(DLL3),partial
- Regular price
- €506,95 EUR
- Sale price
- €506,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Ephrin type-A receptor 3(EPHA3),partial (Active)
- Regular price
- €330,95 EUR
- Sale price
- €330,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Delta-like protein 3(DLL3),partial
- Regular price
- €565,95 EUR
- Sale price
- €565,95 EUR
- Regular price
-
- Unit price
- per
Sold out