
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Neuroscience
Uniprot ID: P20810
Gene Names: CAST
Organism: Homo sapiens (Human)
AA Sequence: MNPTETKAVKTEPEKKSQSTKPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQSAPPEPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPDYRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD
Expression Region: 1-667aa
Sequence Info: Full Length of isoform 4
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 73.9 kDa
Alternative Name(s): Calpain inhibitorSperm BS-17 component
Relevance: Specific inhibition of calpain (calcium-dependent cysteine protease). Plays a key role in postmort tenderization of meat and have been proposed to be involved in muscle protein degradation in living tissue.
Reference: cDNA cloning of human calpastatin sequence homology among human, pig, and rabbit calpastatins.Asada K., Ishino Y., Shimada M., Shimojo T., Endo M., Kimizuka F., Kato I., Maki M., Hatanaka M., Murachi T.J. Enzym. Inhib. 3:49-56(1989)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Calpastatin(CAST)
- Regular price
- €498,95 EUR
- Sale price
- €498,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Calpain-2 catalytic subunit(CAPN2)
- Regular price
- €498,95 EUR
- Sale price
- €498,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Calpain-14(CAPN14),partial
- Regular price
- €411,95 EUR
- Sale price
- €411,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Calpain-2 catalytic subunit(CAPN2)
- Regular price
- €498,95 EUR
- Sale price
- €498,95 EUR
- Regular price
-
- Unit price
- per
Sold out