Recombinant Human BTB-POZ domain-containing protein KCTD15(KCTD15)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human BTB-POZ domain-containing protein KCTD15(KCTD15)

CSB-EP836301HU
Regular price
€498,95 EUR
Sale price
€498,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: Q96SI1

Gene Names: KCTD15

Organism: Homo sapiens (Human)

AA Sequence: MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQDVL

Expression Region: 1-234aa

Sequence Info: Full Length of Isoform 2

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 53.5 kDa

Alternative Name(s): Potassium channel tetramerization domain-containing protein 15

Relevance: During embryonic development, interferes with neural crest formation. Inhibits AP2 transcriptional activity by interaction with its activation domain.

Reference: "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Bcl-2-modifying factor(BMF)
    Regular price
    €498,95 EUR
    Sale price
    €498,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Decorin(DCN)
    Regular price
    €498,95 EUR
    Sale price
    €498,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Catechol O-methyltransferase(COMT),partial
    Regular price
    €498,95 EUR
    Sale price
    €498,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Beta-catenin-interacting protein 1(CTNNBIP1)
    Regular price
    €498,95 EUR
    Sale price
    €498,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share