Recombinant Human BPI fold-containing family A member 2(BPIFA2)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human BPI fold-containing family A member 2(BPIFA2)

CSB-YP839308HU
Regular price
€482,95 EUR
Sale price
€482,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Developmental Biology

Uniprot ID: Q96DR5

Gene Names: BPIFA2

Organism: Homo sapiens (Human)

AA Sequence: ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI

Expression Region: 14-249aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: N-terminal 6xHis-sumostar-tagged

MW: 41.1 kDa

Alternative Name(s): Parotid secretory protein

Relevance: Has strong antibacterial activity against P. aeruginosa.

Reference: "Human parotid secretory protein is a lipopolysaccharide-binding protein: identification of an anti-inflammatory peptide domain." Abdolhosseini M., Sotsky J.B., Shelar A.P., Joyce P.B., Gorr S.U. Mol. Cell. Biochem. 359:1-8(2012)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share