Recombinant Human 60S acidic ribosomal protein P2(RPLP2)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human 60S acidic ribosomal protein P2(RPLP2)

CSB-EP020342HU
Regular price
€639,95 EUR
Sale price
€639,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cancer

Uniprot ID: P05387

Gene Names: RPLP2

Organism: Homo sapiens (Human)

AA Sequence: MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD

Expression Region: 1-115aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 15.7 kDa

Alternative Name(s): Large ribosomal subunit protein P2 Renal carcinoma antigen NY-REN-44 D11S2243E, RPP2

Relevance: Plays an important role in the elongation step of protein synthesis.

Reference: "Human acidic ribosomal phosphoproteins P0, P1, and P2: analysis of cDNA clones, in vitro synthesis, and assembly." Rich B.E., Steitz J.A. Mol. Cell. Biol. 7:4065-4074(1987)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human 60S acidic ribosomal protein P1(RPLP1)
    Regular price
    €500,95 EUR
    Sale price
    €500,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human 60S ribosomal protein L18(RPL18),partial
    Regular price
    €500,95 EUR
    Sale price
    €500,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human 40S ribosomal protein S16(RPS16),partial
    Regular price
    €500,95 EUR
    Sale price
    €500,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human 40S ribosomal protein S9(RPS9),partial
    Regular price
    €500,95 EUR
    Sale price
    €500,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share