Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3(NDUFA3)

CSB-CF609488GGZ-GB

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gorilla gorilla gorilla (Lowland gorilla)

Uniprot NO.:Q0MQ95

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDD GNMPDVPSHPQDPQGPSLEWLKKL

Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 Alternative name(s): Complex I-B9 Short name= CI-B9 NADH-ubiquinone oxidoreductase B9 subunit

Gene Names:Name:NDUFA3

Expression Region:1-84

Sequence Info:full length protein