
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: others
Target / Protein: mppA
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Escherichia coli (strain K12)
Delivery time: 3-7 business days
Uniprot ID: P77348
AA Sequence: AEVPSGTVLAEKQELVRHIKDEPASLDPAKAVGLPEIQVIRDLFEGLVNQNEKGEIVPGVATQWKSNDNRIWTFTLRDNAKWADGTPVTAQDFVYSWQRLVDPKTLSPFAWFAALAGINNAQAIIDGKATPDQLGVTAVDAHTLKIQLDKPLPWFVNLTANFAFFPVQKANVESGKEWTKPGNLIGNGAYVLKERVVNEKLVVVPNTHYWDNAKTVLQKVTFLPINQESAATKRYLAGDIDITESFPKNMYQKLLKDIPGQVYTPPQLGTYYYAFNTQKGPTADQRVRLALSMTIDRRLMTEKVLGTGEKPAWHFTPDVTAGFTPEPSPFEQMSQEELNAQAKTLLSAAGYGPQKPLKLTLLYNTSENHQKIAIAVASMWKKNLGVDVKLQNQEWKTYIDSRNTGNFDVIRASWVGDYNEPSTFLTLLTSTHSGNISRFNNPAYDKVLAQASTENTVKARNADYNAAEKILMEQAPIAPIYQYTNGRLIKPWLKGYPINNPEDVAYSRTMYIVKH
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 23-537aa
Protein length: Full Length of Mature Protein
MW: 73.6 kDa
Alternative Name(s):
Relevance: Essential for the uptake of the murein peptide L-alanyl-gamma-D-glutamyl-meso-diaminopimelate. Also transports some alpha-linked peptides such as Pro-Phe-Lys with low affinity. The transport is effected by the oligopeptide permease system.
Reference: "MppA, a periplasmic binding protein essential for import of the bacterial cell wall peptide L-alanyl-gamma-D-glutamyl-meso-diaminopimelate." Park J.T., Raychaudhuri D., Li H., Normark S., Mengin-Lecreulx D. J. Bacteriol. 180:1215-1223(1998)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Escherichia coli Periplasmic murein peptide-binding protein(mppA)
- Regular price
- €751,95 EUR
- Sale price
- €751,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Anaerobic ribonucleoside-triphosphate reductase(nrdD)
- Regular price
- €751,95 EUR
- Sale price
- €751,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Glutamate--cysteine ligase(gshA)
- Regular price
- €751,95 EUR
- Sale price
- €751,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli O157:H7 Outer membrane protein C (ompC)
- Regular price
- €751,95 EUR
- Sale price
- €751,95 EUR
- Regular price
-
- Unit price
- per
Sold out