
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein: bla
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Escherichia coli (strain K12)
Delivery time: 3-7 business days
Uniprot ID: P28585
AA Sequence: QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL
Tag info: N-terminal 6xHis-tagged
Expression Region: 29-291aa
Protein length: Full Length
MW: 32.2 kDa
Alternative Name(s): Beta-lactamase MEN-1Cefotaximase 1
Relevance: Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins.
Reference: Sequences of beta-lactamase genes encoding CTX-M-1 (MEN-1) and CTX-M-2 and relationship of their amino acid sequences with those of other beta-lactamases.Bauernfeind A., Stemplinger I., Jungwirth R., Casellas J.M.Antimicrob. Agents Chemother. 40:509-513(1996)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla)
- Regular price
- €751,95 EUR
- Sale price
- €751,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla)
- Regular price
- €825,95 EUR
- Sale price
- €825,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla)
- Regular price
- €825,95 EUR
- Sale price
- €825,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Klebsiella pneumoniae Beta-lactamase SHV-1(bla)
- Regular price
- €825,95 EUR
- Sale price
- €825,95 EUR
- Regular price
-
- Unit price
- per
Sold out