Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Equine herpesvirus 1 (strain V592) (EHV-1) (Equine abortion virus)
Uniprot NO.:P84449
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:DPGVKQRIDVAREEERRDFWHAACSGHGFPITTPSTAAILFYVSLLAVGVAVACQAYRAV LRIVTLEMLQHLH
Protein Names:Recommended name: Glycoprotein N Short name= gN
Gene Names:Ordered Locus Names:10
Expression Region:28-100
Sequence Info:full length protein